PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400056040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 222aa    MW: 25251.8 Da    PI: 9.1078
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400056040genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF831.8e-26959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          k+i+n + rqvtfskRr g++KKA+ELS+LCda++ +i+fs tgkl+eyss
  PGSC0003DMP400056040  9 KKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSS 59
                          68***********************************************96 PP

2K-box44.47.2e-1684174999
                 K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                           l++++  s ++ +a L +   +  re+R+l Ge+L+ L l +L++Le+ +e +++++ + K + ++++i+ l+kke +lqeen +L+++
  PGSC0003DMP400056040  84 LHSSNLLSEKKTHAMLSRDFVEKNRELRQLHGEELQGLGLDDLMKLEKLVEGGISRVLKIKGDKFMKEISSLKKKEAQLQEENSQLKQQ 172
                           66677777777788888887777899*************************************************************99 PP

                 K-box  98 le 99 
                            +
  PGSC0003DMP400056040 173 SQ 174
                           76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.777161IPR002100Transcription factor, MADS-box
SMARTSM004327.7E-39160IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-26323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-29383IPR002100Transcription factor, MADS-box
CDDcd002654.45E-37376No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.7E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.86489179IPR002487Transcription factor, K-box
PfamPF014861.3E-1393172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MVRQKIQIKK IDNLTARQVT FSKRRRGLFK KAQELSTLCD ADIGLIVFSA TGKLFEYSSS  60
SMMQLIEKHK MQSERDSMDN PEQLHSSNLL SEKKTHAMLS RDFVEKNREL RQLHGEELQG  120
LGLDDLMKLE KLVEGGISRV LKIKGDKFMK EISSLKKKEA QLQEENSQLK QQSQARLNEE  180
GQNVIEQGHS ADSITNNRSL VNSHQDYNDS DTSLKLCLAF P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17174174Myocyte-specific enhancer factor 2B
1tqe_Q2e-17174174Myocyte-specific enhancer factor 2B
1tqe_R2e-17174174Myocyte-specific enhancer factor 2B
1tqe_S2e-17174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0086520.0AF008652.1 Solanum tuberosum MADS transcriptional factor (Stmads11) mRNA, complete cds.
GenBankAY6437250.0AY643725.1 Solanum tuberosum MADS11 (MADS11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006351733.11e-160PREDICTED: MADS transcriptional factor isoform X1
SwissprotQ9FVC14e-68SVP_ARATH; MADS-box protein SVP
TrEMBLM1D7271e-160M1D727_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000837391e-160(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9382377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.12e-57MIKC_MADS family protein
Publications ? help Back to Top
  1. He C,Saedler H
    Heterotopic expression of MPF2 is the key to the evolution of the Chinese lantern of Physalis, a morphological novelty in Solanaceae.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(16): p. 5779-84
    [PMID:15824316]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Carmona MJ,Ortega N,Garcia-Maroto F
    Isolation and molecular characterization of a new vegetative MADS-box gene from Solanum tuberosum L.
    Planta, 1998. 207(2): p. 181-8
    [PMID:9951721]